Finden Sie Vapreotidacetat, Lab Versorgung Vapreotid Acetat, Peptid Vapreotidacetat auf Industry Directory, zuverlässige Hersteller / Lieferant / Fabrik aus China

Anfrage-Korb (0)
Home > Produkt-Liste > Labor-pharmazeutisches Peptid > Bester Preis Glucagon mit GMP Lab Supply (10 mg / Fläschchen)

Bester Preis Glucagon mit GMP Lab Supply (10 mg / Fläschchen)

Basisinformation

Modell:  16941-32-5

Produktbeschreibung

Model Nr .: 16941-32-5 Customized: Nicht-Customized Geeignet für: Erwachsene Reinheit:> 98% Typ: Pharmazeutische Intermediate Grade: Medizin-Grad Produktname: Glucagon MOQ: 10Vials Funktion: Gesundheit Spezifikation: 10 mg / Fläschchen HS-Code: 2801100000 Powder: Ja Bescheinigung: GMP, HSE, ISO 9001, USP, BP Zustand: Einfarbig Farbe: Weiß Lagerung: Dry Cool Place Zertifikat: GMP CAS: 16941-32-5 Aussehen: Weißes Pulver Handelsmarke: Filter Herkunft: Shanghai Produktdetails: \ n \ n
Product Name: Glucagon
Synonyms: GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS: 16941-32-5
MF: C153H225N43O49S
MW: 3482.75
EINECS: 232-708-2
Product Categories: Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research
Purity: 98%.99%
Molecular structure  
\ n \ nWas ist Glucagonacetat? \ n \ nGlucagon ist ein Peptidhormon, das von Alpha-Zellen der Bauchspeicheldrüse produziert wird und die Konzentration von Glukose im Blutstrom erhöht. Seine Wirkung ist entgegengesetzt zu der von Insulin, das die Glukosekonzentration senkt. Die Bauchspeicheldrüse setzt Glukagon frei, wenn die Konzentration von Glukose im Blutstrom zu niedrig ist. Glucagon bewirkt, dass die Leber gespeichertes Glykogen in Glukose umwandelt, die in den Blutkreislauf freigesetzt wird. Hohe Blutzuckerspiegel stimulieren die Freisetzung von Insulin. Insulin ermöglicht die Aufnahme und Verwendung von Glukose durch insulinabhängige Gewebe. Somit sind Glucagon und Insulin Teil eines Rückkopplungssystems, das den Blutzuckerspiegel auf einem stabilen Niveau hält. Glucagon gehört zu einer Familie anderer verwandter Hormone. \ N \ n \ n \ nWAS WÄHLEN SIE UNSEREN FILTER?
1. GMP manufacturer
2. Competitive price and high quality 
3. A powerful peptide manufactory 
4.25years Years of experience in the pharmaceutical and good reputation.
5. Secure shipping and delivery guaranteed.

Produktgruppe : Labor-pharmazeutisches Peptid