Finden Sie Fabrikpreis, Pharmazeutisches Zwischenprodukt, Thymosin Beta auf Industry Directory, zuverlässige Hersteller / Lieferant / Fabrik aus China

Anfrage-Korb (0)
Home > Produkt-Liste > Thymosin Beta > Pharmazeutisches Zwischenprodukt Thymosin Beta 4 Tb-500 CAS 77591-33-4 Laborforschung

Pharmazeutisches Zwischenprodukt Thymosin Beta 4 Tb-500 CAS 77591-33-4 Laborforschung

Basisinformation

Modell:  API

Produktbeschreibung

Model Nr .: API Kundenspezifisch: Kundenspezifisch Geeignet für: Erwachsene Reinheit:> 98% Versandmethoden: DHL TNT FedEx EMS Lagerung: Kühl und trocken Ort Markenzeichen: Filter Spezifikation: 5MG / Fläschchen HS-Code: 2801100000 Pulver: Ja Zertifizierung: GMP Zustand: Solid Shelf Life: 2 Jahre Herkunftsort: China Reinheit: 0% 98% Transport-Paket: Kunststoff-Röhrchen, Phiole, Box Herkunft: Shanghai Pharmaceutical Intermediate Thymosin Beta 4 TB-500 CAS 77591-33-4 \ n

Sequence

Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH

One Letter Sequence

Ac-SDKPDMAEIE KFDKSKLKKT ETQEKNPLPS KETIEQEKQA GES

Physical Apperance

White Powder

Form & Formulations

Sterile Filtered white lyophilized (freeze-dried)

Stability

2 months at room temperature 24 months from date of receipt, ­20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, ­20 to ­70 °C under sterile conditions after reconstitution.

Purity

>98% by RP-HPLC

Storage

Lyophilized Thymosin Beta 4(TB500) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.
\ n \ n \ nThymosin Beta 4 ist ein natürlich vorkommendes Peptid. Es wird in hohen Konzentrationen in Blutplättchen, Wundflüssigkeit und anderen Geweben im Körper gefunden. Tβ4 ist kein Wachstumsfaktor; vielmehr ist es ein Hauptaktin, das Peptid reguliert. Es wurde gefunden, dass T & bgr; 4 eine wichtige Rolle beim Schutz, der Regeneration und dem Remodelling von verletztem oder geschädigtem Gewebe spielt. Es wurde auch festgestellt, dass das Gen für T & bgr; 4 als eines der ersten nach einer Wunde hochreguliert ist. Thymosin beta 4 verbessert die Hyperglykämie und verbessert die Insulinresistenz der KK Cg-Ay / J-Maus Diabetes mellitus und ist zudem mit einem erhöhten Risiko für kardiovaskuläre Erkrankungen (CVD) assoziiert [1-3]. Es gibt viele Medikamente auf dem Markt, die darauf abzielen, die Insulinresistenz zu verbessern. Neben Metformin haben andere Arzneimittel schwerwiegende Nebenwirkungen gehabt und wurden entweder vom Markt genommen oder ernsthaften Warnungen ausgesetzt. Zum Beispiel wurde festgestellt, dass Rosiglitazon, ein Insulinsensibilisator, der durch Bindung an die PPAR-Rezeptoren in Fettzellen reagiert und die Zellen auf Insulin anspricht, mit einem erhöhten Risiko für einen Herzinfarkt assoziiert ist [4]. Daher ist es sehr wichtig, neue potentielle Insulinsensibilisatoren zu erforschen, die nicht nur die Insulinresistenz verbessern, sondern auch das Risiko für kardiovaskuläre Erkrankungen senken können. Thymosin Beta 4 (Tβ4) ist ein wichtiges intrazelluläres G-Actin-Sequestrierungspeptid mit der Aminosäuresequenz Ac -SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. Studien haben gezeigt, dass die Tβ4-Spiegel in Hornhäuten diabetischer Patienten im Vergleich zu gesunden Probanden signifikant abnahmen, und exogene Tβ4-Verabreichung würde die Wundheilung bei diabetischen und nichtdiabetischen Hornhäuten fördern. Tβ4 könnte auch die Glukoseintoleranz verbessern und die Insulinresistenz bei KK-Mäusen verbessern, was darauf hinweist, dass Tβ4 ein möglicher alternativer Insulinsensibilisator für die Behandlung von Typ-2-Diabetes mellitus sein könnte. \ N \ nFür Forschungszwecke, nicht für den menschlichen Verzehr \ n \ nWJA WÄHLEN SIE UNSER FILTER?

1. GMP manufacturer

2. Competitive price and high quality 

3. A powerful peptide manufactory 

4.over 10 years  experience in the pharmaceutical and good reputation.

5. Secure shipping and delivery guaranteed.
\ n \ nKontaktinformationen \ n \ nPeptidkategorien \ nVerpackung und Versand.Unsere Lab \ nKontaktinformationen \ n008618203638264 \ n \ n

Produktgruppe : Thymosin Beta

Mail an Lieferanten
  • *Fach:
  • Um:

  • *Nachrichten:
    Ihre Nachrichten muss zwischen 20-8000 Zeichen sein

Premium Related Products